PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400035081
Common NameLOC102581569
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 142aa    MW: 16454.8 Da    PI: 9.9554
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400035081genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.52.7e-3355113159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK vk++++prsYYrCt++gC+vkk+v+r ++d++vv++tYeg H+h+
  PGSC0003DMP400035081  55 LDDGYRWRKYGQKAVKNNNYPRSYYRCTHEGCNVKKQVQRLSKDETVVVTTYEGMHTHP 113
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.7E-3540113IPR003657WRKY domain
SuperFamilySSF1182908.11E-3047114IPR003657WRKY domain
PROSITE profilePS5081130.11350115IPR003657WRKY domain
SMARTSM007748.6E-3955114IPR003657WRKY domain
PfamPF031063.4E-2756113IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MENVVVGYYS MNGGLKTTSR DEMMGVVQNH NLSVKNKKIK KPRFAFQTKS QVDILDDGYR  60
WRKYGQKAVK NNNYPRSYYR CTHEGCNVKK QVQRLSKDET VVVTTYEGMH THPIDKPNDN  120
FEQILHQMHI LPNPPIPIPF N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-2845114776Probable WRKY transcription factor 4
2lex_A1e-2845114776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755142e-85HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006338711.11e-103PREDICTED: probable WRKY transcription factor 45
SwissprotQ9FYA22e-49WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLM1BSQ71e-103M1BSQ7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000520571e-103(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22042461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.18e-50WRKY DNA-binding protein 75
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]